PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00920.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 289aa    MW: 33581.2 Da    PI: 5.0687
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00920.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.6e-142067148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd ll  ++   G g+W++ a++ g++Rt+k+c++rw++yl
  Rsa1.0_00920.1_g00028.1 20 RGPWTLEEDTLLTTYILHNGEGRWNLAAKCAGLKRTGKSCRLRWLNYL 67
                             89********************************************97 PP

2Myb_DNA-binding51.91.8e-1673116146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Rsa1.0_00920.1_g00028.1  73 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.0911567IPR017930Myb domain
SuperFamilySSF466891.61E-2918114IPR009057Homeodomain-like
SMARTSM007172.5E-111969IPR001005SANT/Myb domain
PfamPF002494.6E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-212174IPR009057Homeodomain-like
CDDcd001673.99E-82267No hitNo description
PROSITE profilePS5129425.26468122IPR017930Myb domain
SMARTSM007171.4E-1472120IPR001005SANT/Myb domain
PfamPF002491.5E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-2375121IPR009057Homeodomain-like
CDDcd001676.19E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MENSMKNKSF KESEEAELRR GPWTLEEDTL LTTYILHNGE GRWNLAAKCA GLKRTGKSCR  60
LRWLNYLKPD IRRGNLTPQE QLLILELHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWVPRLIEKM EQNSSTTYTC PQNNNNNNSN NSLLLPTQSF  180
ESMSTQTYTD FSCQNPCLSN MDGSSSSSAF MPDLTTVQHI TDHNTVIDDS MFNHEGNASQ  240
ELTGYIPGME EYYYTGNSDI STECHVAEAY ENVTQDPMWN MDDIWQFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-24171221105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-2311221128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756550.0KM975655.1 Brassica napus MYB transcription factor 62.1 (MYB62.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013701292.11e-179PREDICTED: transcription factor MYB24-like
SwissprotQ9LDE13e-64MY108_ARATH; Transcription factor MYB108
TrEMBLA0A078E9K81e-178A0A078E9K8_BRANA; BnaA07g26980D protein
STRINGBra004297.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-147myb domain protein 62